HPA011905

PDCD6IP antibody from Atlas Antibodies
AIP1, Alix, Hp95
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA011905
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011905, RRID:AB_1235125
Product name
Anti-PDCD6IP
Provider product page
Atlas Antibodies - HPA011905
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLAN
GVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQG
GIQTVDQLIKELPELLQRNREILDESLRLLDEEEA
TDND
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -