HPA011905

PDCD6IP antibody from Atlas Antibodies
AIP1, Alix, Hp95
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011905
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011905, RRID:AB_1855111
Product name
Anti-PDCD6IP
Provider product page
Atlas Antibodies - HPA011905
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VPVSVQQSLAAYNQRKADLVNRSIAQMREATTLAN
GVLASLNLPAAIEDVSGDTVPQSILTKSRSVIEQG
GIQTVDQLIKELPELLQRNREILDESLRLLDEEEA
TDND
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -