H00055294-M02
antibody from Abnova Corporation
Targeting: FBXW7
AGO, CDC4, FBW7, FBX30, FBXW6, FLJ11071, SEL-10, SEL10
Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055294-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055294-M02, RRID:AB_581682
- Product name
- FBXW7 monoclonal antibody (M02), clone 3D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FBXW7.
- Antigen sequence
ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFN
KNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGS
GGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFD
VDMK- Isotype
- IgG
- Antibody clone number
- 3D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references F-box protein FBXW7 inhibits cancer metastasis in a non-cell-autonomous manner.
Genomic and molecular characterization of esophageal squamous cell carcinoma.
FBXW7 mediates chemotherapeutic sensitivity and prognosis in NSCLCs.
Structural basis for a reciprocal regulation between SCF and CSN.
Yumimoto K, Akiyoshi S, Ueo H, Sagara Y, Onoyama I, Ueo H, Ohno S, Mori M, Mimori K, Nakayama KI
The Journal of clinical investigation 2015 Feb;125(2):621-35
The Journal of clinical investigation 2015 Feb;125(2):621-35
Genomic and molecular characterization of esophageal squamous cell carcinoma.
Lin DC, Hao JJ, Nagata Y, Xu L, Shang L, Meng X, Sato Y, Okuno Y, Varela AM, Ding LW, Garg M, Liu LZ, Yang H, Yin D, Shi ZZ, Jiang YY, Gu WY, Gong T, Zhang Y, Xu X, Kalid O, Shacham S, Ogawa S, Wang MR, Koeffler HP
Nature genetics 2014 May;46(5):467-73
Nature genetics 2014 May;46(5):467-73
FBXW7 mediates chemotherapeutic sensitivity and prognosis in NSCLCs.
Yokobori T, Yokoyama Y, Mogi A, Endoh H, Altan B, Kosaka T, Yamaki E, Yajima T, Tomizawa K, Azuma Y, Onozato R, Miyazaki T, Tanaka S, Kuwano H
Molecular cancer research : MCR 2014 Jan;12(1):32-7
Molecular cancer research : MCR 2014 Jan;12(1):32-7
Structural basis for a reciprocal regulation between SCF and CSN.
Enchev RI, Scott DC, da Fonseca PC, Schreiber A, Monda JK, Schulman BA, Peter M, Morris EP
Cell reports 2012 Sep 27;2(3):616-27
Cell reports 2012 Sep 27;2(3):616-27
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FBXW7 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FBXW7 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol