Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010235-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010235-M09, RRID:AB_606917
- Product name
- RASGRP2 monoclonal antibody (M09), clone 3D8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RASGRP2.
- Antigen sequence
GTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVR
MFLMMHPWYIPSSQLAAKLLHIYQQSRKDNSNSLQ
VKTCHLVRYWISAFPAEFDLNPELAEQIKE- Isotype
- IgG
- Antibody clone number
- 3D8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Calcium-diacylglycerol guanine nucleotide exchange factor I gene mutations associated with loss of function in canine platelets.
Boudreaux MK, Catalfamo JL, Klok M
Translational research : the journal of laboratory and clinical medicine 2007 Aug;150(2):81-92
Translational research : the journal of laboratory and clinical medicine 2007 Aug;150(2):81-92
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of RASGRP2 expression in transfected 293T cell line by RASGRP2 monoclonal antibody (M09), clone 3D8.Lane 1: RASGRP2 transfected lysate(75.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged RASGRP2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol