HPA015667

RASGRP2 antibody from Sigma-Aldrich
CALDAG-GEFI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015667
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015667, RRID:AB_1856090
Product name
Anti-RASGRP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015667
Antibody type
Polyclonal
Antigen
RAS guanyl-releasing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHI
YQQSRKDNSNSLQVKTCHLVRYWISAFPAEFDLNP
ELAEQIKELKALLDQEGNRRHSSLIDIDSVPTYKW
KRQVTQRNPV
Storage
-20C
Provider Type Product Number
- No reagents -