Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [9]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91089 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91089, RRID:AB_2665795
- Product name
- Anti-DDC
- Antibody type
- Monoclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
LETVMMDWLGKMLELPKAFLNEKAGEGGGVIQGSA
SEATLVALLAARTKVIHRLQAASPELTQAAIMEKL
VAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMR
ASA- Epitope
- Binds to an epitope located within the peptide sequence MDWLGKMLEL as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL2962
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Kidney tissue
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human kidney and fallopian tube tissues using AMAb91089 antibody. Corresponding DDC RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of rat substantia nigra shows strong immunoreactivity in dopamine neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of mouse substantia nigra shows strong positivity in dopamine neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human substantia nigra shows strong immunoreactivity in dopamine neurons.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of rat substantia nigra shows strong positivity in dopamine neurons in pars compacta.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse substantia nigra shows strong positivity in dopamine neurons in pars compacta.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human substantia nigra shows cytoplasmic positivity in dopamine neurons in pars compacta.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows no positivity in glandular cells as expected.