HPA007888

ADA2 antibody from Atlas Antibodies
ADGF, CECR1, IDGFL
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007888
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007888, RRID:AB_1078495
Product name
Anti-CECR1
Provider product page
Atlas Antibodies - HPA007888
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TDWQGTSIDRNILDALMLNTTRIGHGFALSKHPAV
RTYSWKKDIPIEVCPISNQVLKLVSDLRNHPVATL
MATGHPMVISSDDPAMFGAKGLSYDFYEVFMGIGG
MKADLRTLKQLAMNSIKYSTLLESEKNTFMEIWKK
RWDK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -