Antibody data

Product number
H00003376-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003376-M03, RRID:AB_1237745
Product name
IARS monoclonal antibody (M03), clone 3D3
Provider product page
Abnova Corporation - H00003376-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant IARS.
Antigen sequence
QYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLT
HQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDI
PVKTLNMKTVYVSVLPTTADF
Isotype
IgG
Antibody clone number
3D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -