SAB1400131

IARS1 antibody from MilliporeSigma / Merck KGaA
IARS, ILRS
ELISA
Recommended by provider

Antibody data

Product number
SAB1400131
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1400131, RRID:AB_1851360
Product name
Anti-IARS antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1400131
Antibody type
Polyclonal
Antigen
IARS (AAH65552.1, a.a. 1-1055) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MESVWWVFKQLYDKGLVYRGVKVMPFSTACNTPLS
NFESHQNYKDVQDPSVFVTFPLEEDETVSLVAWTT
TPWTLPSNLAVCVNPEMQYVKIKDVARGRLLILME
ARLSALYKLESDYEILERFPGAYLKGKKYRPLFDY
FLKCKENGAFTVLVDNYVKEEEGTGVVHQAPYFGA
EDYRVCMDFNIIRKDSLPVCPVDASGCFTTEVTDF
AGQYVKDADKSIIRTLKEQGRLLVATTFTHSYPFC
WRSDTPLIYKAVPSWFVRVENMVDQLLRNNDLCYW
VPELVREKRFGNWLKDARDWTISRNRYWGTPIPLW
VSDDFEEVVCIGSVAELEELSGAKISDLHRESVDH
LTIPSRCGKGSLHRISEVFDCWFESGSMPYAQVHY
PFENKREFEDAFPADFIAEGIDQTRGWFYTLLVLA
TALFGQPPFKNVIVNGLVLASDGQKMSKRKKNYPD
Storage
-20C
Provider Type Product Number
- No reagents -