Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026270-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026270-M01, RRID:AB_425932
- Product name
- FBXO6 monoclonal antibody (M01), clone 3F10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FBXO6.
- Antigen sequence
MDAPHSKAALDSINELPENILLELFTHVPARQLLL
NCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQ
PVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDF
NGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMC
LKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARA
DCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNN
ATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGW
YGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEE
AAQSPYRAVVQIF- Isotype
- IgG
- Antibody clone number
- 3F10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FBXO6 expression in transfected 293T cell line by FBXO6 monoclonal antibody (M01), clone 3F10.Lane 1: FBXO6 transfected lysate(33.933 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of FBXO6 transfected lysate using anti-FBXO6 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FBXO6 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol