Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011316-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011316-A01, RRID:AB_489591
- Product name
- COPE polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant COPE.
- Antigen sequence
KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDK
DSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDA
HRSHPFIKEYQAKENDFDRLVLQYAPSA- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Depletion of beta-COP reveals a role for COP-I in compartmentalization of secretory compartments and in biosynthetic transport of caveolin-1.
Styers ML, O'Connor AK, Grabski R, Cormet-Boyaka E, Sztul E
American journal of physiology. Cell physiology 2008 Jun;294(6):C1485-98
American journal of physiology. Cell physiology 2008 Jun;294(6):C1485-98
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- COPE polyclonal antibody (A01), Lot # 060116JC01 Western Blot analysis of COPE expression in HL-60 ( Cat # L014V1 ).