HPA013331

MYL7 antibody from Atlas Antibodies
MYL2A, MYLC2A
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013331
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013331, RRID:AB_1854245
Product name
Anti-MYL7
Provider product page
Atlas Antibodies - HPA013331
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DPEEAILSAFRMFDPSGKGVVNKDEFKQLLLTQAD
KFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGD
EK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -