HPA017962

MAP3K8 antibody from Sigma-Aldrich
c-COT, COT, EST, ESTF, MEKK8, Tpl-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017962
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017962, RRID:AB_1853776
Product name
Anti-MAP3K8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017962
Antibody type
Polyclonal
Antigen
Mitogen-activated protein kinase kinase kinase 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENLYASEEPAVYEPSLMTMCQDSNQNDERSKSLLL
SGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYG
QRPQESGILLNMVITPQNGRYQIDSDVLLIPWKLT
YRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIP
VDQFKPSDV
Storage
-20C
Provider Type Product Number
- No reagents -