Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00084665-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00084665-M04, RRID:AB_534947
- Product name
- MYPN monoclonal antibody (M04), clone 4C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MYPN.
- Antigen sequence
PDLSAFLSQEELDESVNLARLAINYDPLEKADETQ
ARKRLSPDQMKHSPNLSFEPNFCQDNPRSPTSSKE
SPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLF
KSHSS- Isotype
- IgG
- Antibody clone number
- 4C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MYPN monoclonal antibody (M04), clone 4C8 Western Blot analysis of MYPN expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MYPN is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol