HPA013707

ADGRE5 antibody from MilliporeSigma / Merck KGaA
CD97, TM7LN1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013707
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA013707, RRID:AB_1846345
Product name
Anti-CD97 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA013707
Antibody type
Polyclonal
Antigen
CD97 antigen precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPP
VRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPS
NTELTLMIQERGDKNVTMGQ
Storage
-20C
Provider Type Product Number
- No reagents -