HPA013707

ADGRE5 antibody from Atlas Antibodies
CD97, TM7LN1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013707
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013707, RRID:AB_1233797
Product name
Anti-ADGRE5
Provider product page
Atlas Antibodies - HPA013707
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RDSKTSSAEVTIQNVIKLVDELMEAPGDVEALAPP
VRHLIATQLLSNLEDIMRILAKSLPKGPFTYISPS
NTELTLMIQERGDKNVTMGQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -