Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503575 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Centromere Protein I (CENPI) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CENPI antibody: synthetic peptide directed towards the N terminal of human CENPI
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDP
SNSKN ISKHGQNNPV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
Izuta H, Ikeno M, Suzuki N, Tomonaga T, Nozaki N, Obuse C, Kisu Y, Goshima N, Nomura F, Nomura N, Yoda K
Genes to cells : devoted to molecular & cellular mechanisms 2006 Jun;11(6):673-84
Genes to cells : devoted to molecular & cellular mechanisms 2006 Jun;11(6):673-84
No comments: Submit comment
No validations: Submit validation data