HPA015638

ADGRE3 antibody from Sigma-Aldrich
EMR3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015638
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015638, RRID:AB_1848039
Product name
Anti-EMR3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015638
Antibody type
Polyclonal
Antigen
EGF-like module-containing mucin-like hormone receptor-like 3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDI
NECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLH
SGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDK
FESLLTNQTLWRTEGRQEISSTATTILRDVESKVL
Storage
-20C
Provider Type Product Number
- No reagents -