HPA014492

PDE3A antibody from Sigma-Aldrich
CGI-PDE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014492
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014492, RRID:AB_1855120
Product name
Anti-PDE3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014492
Antibody type
Polyclonal
Antigen
cGMP-inhibited 3',5'-cyclic phosphodiesterase A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPQILTPPVICSSCGRPYSQGNPADEPLERSGVAT
RTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETE
CLREPLRKASACSTYAPETMMFLDKPILAPEPLVM
DNLDSIMEQLNT
Storage
-20C
Provider Type Product Number
- No reagents -