Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009709-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009709-M04, RRID:AB_530076
- Product name
- HERPUD1 monoclonal antibody (M04), clone 2G7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant HERPUD1.
- Antigen sequence
PKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEP
AGSNRGQYPEDSSSDGLRQREVLRNLSSPGWENIS
RPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYA
RQ- Isotype
- IgG
- Antibody clone number
- 2G7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Radioprotective effects of genistein on HL-7702 cells via the inhibition of apoptosis and DNA damage.
BRSK2 is regulated by ER stress in protein level and involved in ER stress-induced apoptosis.
Decreased ER-associated degradation of alpha-TCR induced by Grp78 depletion with the SubAB cytotoxin.
Song L, Ma L, Cong F, Shen X, Jing P, Ying X, Zhou H, Jiang J, Fu Y, Yan H
Cancer letters 2015 Sep 28;366(1):100-11
Cancer letters 2015 Sep 28;366(1):100-11
BRSK2 is regulated by ER stress in protein level and involved in ER stress-induced apoptosis.
Wang Y, Wan B, Li D, Zhou J, Li R, Bai M, Chen F, Yu L
Biochemical and biophysical research communications 2012 Jul 13;423(4):813-8
Biochemical and biophysical research communications 2012 Jul 13;423(4):813-8
Decreased ER-associated degradation of alpha-TCR induced by Grp78 depletion with the SubAB cytotoxin.
Lass A, Kujawa M, McConnell E, Paton AW, Paton JC, Wójcik C
The international journal of biochemistry & cell biology 2008;40(12):2865-79
The international journal of biochemistry & cell biology 2008;40(12):2865-79
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- HERPUD1 monoclonal antibody (M04), clone 2G7 Western Blot analysis of HERPUD1 expression in HepG2 ( Cat # L019V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of HERPUD1 expression in transfected 293T cell line by HERPUD1 monoclonal antibody (M04), clone 2G7.Lane 1: HERPUD1 transfected lysate(44 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged HERPUD1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of HERPUD1 transfected lysate using anti-HERPUD1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HERPUD1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to HERPUD1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol