Antibody data

Product number
H00009559-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009559-M02, RRID:AB_1205167
Product name
VPS26A monoclonal antibody (M02), clone 1C4
Provider product page
Abnova Corporation - H00009559-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant VPS26A.
Antigen sequence
ETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMR
DVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRK
APEKLRKQRTNFHQRFESPESQASAEQPEM
Isotype
IgG
Antibody clone number
1C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -