H00005696-M05

PSMB8 antibody from Abnova Corporation
beta5i, D6S216E, LMP7, PSMB5i, RING10
No application information provided.

Antibody data

Product number
H00005696-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005696-M05, RRID:AB_1137396
Product name
PSMB8 monoclonal antibody (M05), clone 4E4
Provider product page
Abnova Corporation - H00005696-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PSMB8.
Antigen sequence
DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVM
DSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVV
NMYHMKEDGWVKVESTDVSDLLHQYREANQ
Isotype
IgG
Antibody clone number
4E4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -