PAB21237
antibody from Abnova Corporation
Targeting: TRIOBP
DFNB28, HRIHFB2122, KIAA1662, TAP68, Tara
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB21237 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB21237, RRID:AB_10961644
- Product name
- TRIOBP polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant TRIOBP.
- Antigen sequence
ATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEI
EKKWQELEKLPLRENKRVPLTALLNQSRGERRGPP
SDGHEALEKEVQALRAQLEAWRLQGEAPQSA- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with TRIOBP polyclonal antibody (Cat # PAB21237) at 1:250-1:500 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A-431 with TRIOBP polyclonal antibody (Cat # PAB21237) at 1-4 ug/mL dilution shows positivity in cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human rectum with TRIOBP polyclonal antibody (Cat # PAB21237) shows strong cytoplasmic and membranous positivity in glandular cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)