ABIN501329
antibody from antibodies-online
Targeting: TRIOBP
DFNB28, HRIHFB2122, KIAA1662, TAP68, Tara
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501329 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-TRIO and F-Actin Binding Protein (TRIOBP) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRIOBP antibody: synthetic peptide directed towards the middle region of human TRIOBP
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
QIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPTSA
PDVTK LSDSNKENAL- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The E3 ubiquitin ligase HECTD3 regulates ubiquitination and degradation of Tara.
Yu J, Lan J, Zhu Y, Li X, Lai X, Xue Y, Jin C, Huang H
Biochemical and biophysical research communications 2008 Mar 21;367(4):805-12
Biochemical and biophysical research communications 2008 Mar 21;367(4):805-12
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Immunohistochemistry