ABIN501329
antibody from antibodies-online
		Targeting: TRIOBP
		
		DFNB28, HRIHFB2122, KIAA1662, TAP68, Tara	
	
	
	
	
Antibody data
- Antibody Data
 - Antigen structure
 - References [1]
 - Comments [0]
 - Validations
 - Western blot [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - ABIN501329 - Provider product page

 - Provider
 - antibodies-online
 - Product name
 - anti-TRIO and F-Actin Binding Protein (TRIOBP) (Middle Region) antibody
 - Antibody type
 - Polyclonal
 - Antigen
 - The immunogen for anti-TRIOBP antibody: synthetic peptide directed towards the middle region of human TRIOBP
 - Description
 - Affinity Purified
 - Reactivity
 - Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
 - Host
 - Rabbit
 - Antigen sequence
 QIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPTSA
PDVTK LSDSNKENAL- Epitope
 - Middle Region
 - Vial size
 - 50 μg
 - Concentration
 - 1mg/mL
 - Storage
 - -20°C
 - Handling
 - Avoid repeated freeze-thaw cycles.
 
Submitted references		The E3 ubiquitin ligase HECTD3 regulates ubiquitination and degradation of Tara.
				
		
	
			Yu J, Lan J, Zhu Y, Li X, Lai X, Xue Y, Jin C, Huang H
Biochemical and biophysical research communications 2008 Mar 21;367(4):805-12
		Biochemical and biophysical research communications 2008 Mar 21;367(4):805-12
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - antibodies-online (provider)
 - Main image
 
- Experimental details
 - Image(s): Western Blotting
 
							
					Supportive validation
					
									
				
		- Submitted by
 - antibodies-online (provider)
 - Main image
 
- Experimental details
 - Image(s): Immunohistochemistry