HPA015955

CTNND1 antibody from Sigma-Aldrich
CTNND, KIAA0384, p120, p120cas, p120ctn
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015955
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015955, RRID:AB_1846068
Product name
Anti-CTNND1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015955
Antibody type
Polyclonal
Antigen
Catenin delta-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQ
DANPLMANGTLTRRHQNGRFVGDADLERQKFSDLK
LNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEG
AMSVVSVETSDDGTTR
Storage
-20C
Provider Type Product Number
- No reagents -