HPA015955

CTNND1 antibody from Atlas Antibodies
CTNND, KIAA0384, p120, p120cas, p120ctn
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015955
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015955, RRID:AB_1233687
Product name
Anti-CTNND1
Provider product page
Atlas Antibodies - HPA015955
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQ
DANPLMANGTLTRRHQNGRFVGDADLERQKFSDLK
LNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEG
AMSVVSVETSDDGTTR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -