PAB15704

FBXW11 antibody from Abnova Corporation
BTRC2, BTRCP2, Fbw11, Fbw1b, FBXW1B, Hos, KIAA0696
No application information provided.

Antibody data

Product number
PAB15704
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB15704, RRID:AB_10676160
Product name
Fbxw11 polyclonal antibody
Provider product page
Abnova Corporation - PAB15704
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against partial recombinant Fbxw11.
Antigen sequence
CLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWD
LQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQ
IISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTY
ISR
Storage
Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -