HPA015597

PLCE1 antibody from Sigma-Aldrich
KIAA1516, NPHS3, PLCE
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015597
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015597, RRID:AB_1855321
Product name
Anti-PLCE1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015597
Antibody type
Polyclonal
Antigen
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase epsilon-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDR
RMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNY
VAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFC
FEGSCEKVDMVYSGDSFCRKDFTDSQAAKT
Storage
-20C
Provider Type Product Number
- No reagents -