Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA015598 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA015598, RRID:AB_1855322
- Product name
- Anti-PLCE1
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKES
TVNSIFQVIRSCNRSLETDEEDSPSEGNSSRKSSL
KDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDS
QKAFDHGTELIPWYVLSIQADVHQFLLQGATVIHY
DQD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PLCE1 Polymorphisms and Risk of Esophageal and Gastric Cancer in a Northwestern Chinese Population
Epigenetically upregulated oncoprotein PLCE1 drives esophageal carcinoma angiogenesis and proliferation via activating the PI-PLCε-NF-κB signaling pathway and VEGF-C/ Bcl-2 expression
MicroRNA-34a functions as a tumor suppressor by directly targeting oncogenic PLCE1 in Kazakh esophageal squamous cell carcinoma
Targeting oncogenic PLCE1 by miR-145 impairs tumor proliferation and metastasis of esophageal squamous cell carcinoma
Liang P, Zhang W, Wang W, Dai P, Wang Q, Yan W, Wang W, Lei X, Cui D, Yan Z
BioMed Research International 2019;2019
BioMed Research International 2019;2019
Epigenetically upregulated oncoprotein PLCE1 drives esophageal carcinoma angiogenesis and proliferation via activating the PI-PLCε-NF-κB signaling pathway and VEGF-C/ Bcl-2 expression
Chen Y, Wang D, Peng H, Chen X, Han X, Yu J, Wang W, Liang L, Liu Z, Zheng Y, Hu J, Yang L, Li J, Zhou H, Cui X, Li F
Molecular Cancer 2019;18(1)
Molecular Cancer 2019;18(1)
MicroRNA-34a functions as a tumor suppressor by directly targeting oncogenic PLCE1 in Kazakh esophageal squamous cell carcinoma
Cui X, Peng H, Li R, Mu J, Yang L, Li N, Liu C, Hu J, Li S, Wei Y, Laibo-Yin , Zhou H, Li F, Chen Y
Oncotarget 2017;8(54):92454-92469
Oncotarget 2017;8(54):92454-92469
Targeting oncogenic PLCE1 by miR-145 impairs tumor proliferation and metastasis of esophageal squamous cell carcinoma
Cui X, Li S, Li T, Peng H, Jin T, Zhang S, Liu C, Yang L, Shen Y, Li S, Li N, Li Y, Hu J, Jiang J, Suo J, Qi Y, Liang W, Wang L, Dang H, Li L, Cao W, Wei Y, Laibo-Yin , Wu C, Yuan X, Zhou H, Zheng Y, Chen Y, Li F
Oncotarget 2015;7(2):1777-1795
Oncotarget 2015;7(2):1777-1795
No comments: Submit comment
No validations: Submit validation data