Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039785 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-NEUROG3
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSA
PPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSR
PKSELALSKQRRSRR- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Neurogenin 3 is regulated by neurotrophic tyrosine kinase receptor type 2 (TRKB) signaling in the adult human exocrine pancreas
Neurogenin 3 Expressing Cells in the Human Exocrine Pancreas Have the Capacity for Endocrine Cell Fate
Shamblott M, O’Driscoll M, Gomez D, McGuire D
Cell Communication and Signaling 2016;14(1)
Cell Communication and Signaling 2016;14(1)
Neurogenin 3 Expressing Cells in the Human Exocrine Pancreas Have the Capacity for Endocrine Cell Fate
Rakonczay Z, Gomez D, O’Driscoll M, Sheets T, Hruban R, Oberholzer J, McGarrigle J, Shamblott M
PLOS ONE 2015;10(8):e0133862
PLOS ONE 2015;10(8):e0133862
No comments: Submit comment
No validations: Submit validation data