HPA013819

ACKR2 antibody from Sigma-Aldrich
CCBP2, CCR10, CCR9, CMKBR9, D6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013819
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013819, RRID:AB_1846126
Product name
Anti-CCBP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013819
Antibody type
Polyclonal
Antigen
Chemokine-binding protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QYLKAFLAAVLGWHLAPGTAQASLSSCSESSILTA
QEEMTGMNDLGERQSENYPNKEDVGNKSA
Storage
-20C
Provider Type Product Number
- No reagents -