Antibody data

Product number
H00009055-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009055-M03, RRID:AB_1237833
Product name
PRC1 monoclonal antibody (M03), clone 3B10-1F9
Provider product page
Abnova Corporation - H00009055-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PRC1.
Antigen sequence
MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQ
RLQRTEVVKKHIKELLDMMIAEEESLKERLIKSIS
VCQKELNTLCSELHVEPFQEEGETTILQLEKDLRT
QVELMRKQKKERKQELKLLQEQDQELCEILCMPHY
DIDSASVPSLEELNQFRQHVTTLRETKASRREEFV
SIKRQIILCMEELDHTPDTSFERDVVCEDEDAFCL
SLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRE
LWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVD
RLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQR
QAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKE
LFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNL
LKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKA
FMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNK
KQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNT
TTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKP
VAASTCSGKKTPRTGRHGANKENLELNGSILSGGY
PGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVG
LQRELSKASKSDATSGILNSTNIQS
Isotype
IgG
Antibody clone number
3B10-1F9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -