HPA000861

UBR7 antibody from Sigma-Aldrich
C14orf130
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000861
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000861, RRID:AB_1078321
Product name
Anti-UBR7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000861
Antibody type
Polyclonal
Antigen
Putative E3 ubiquitin-protein ligase UBR7 (N-recognin-7)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RQSELEPVVSLVDVLEEDEELENEACAVLGGSDSE
KCSYSQGSVKRQALYACSTCTPEGEEPAGICLACS
YECHGSHKLFELYTKRNFRCDCGNSKFKNLECKLL
PDKAKVNSGNKYNDNFFGLYCICKRPYPDPEDEI
Storage
-20C
Provider Type Product Number
- No reagents -