Antibody data

Product number
H00283349-M15
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00283349-M15, RRID:AB_1237841
Product name
RASSF3 monoclonal antibody (M15), clone 3A5
Provider product page
Abnova Corporation - H00283349-M15
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RASSF3.
Antigen sequence
QGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNL
AVTDKLKMTLNSNGIYTGFIKVQMELCKPPQTSPN
SGKLSPSSNGCMNT
Isotype
IgG
Antibody clone number
3A5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -