HPA014011

HTR2A antibody from Sigma-Aldrich
5-HT2A, HTR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014011
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014011, RRID:AB_1856709
Product name
Anti-HTR2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014011
Antibody type
Polyclonal
Antigen
5-hydroxytryptamine receptor 2A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSS
EKLFQRSIHREPGSYTGRRTMQSISNEQ
Storage
-20C
Provider Type Product Number
- No reagents -