H00006945-M07

MLX antibody from Abnova Corporation
bHLHd13, MAD7, MXD7, TCFL4

Antibody data

Product number
H00006945-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006945-M07, RRID:AB_1577331
Product name
MLX monoclonal antibody (M07), clone 1C3
Provider product page
Abnova Corporation - H00006945-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MLX.
Antigen sequence
MTEPGASPEDPWVKVEYAYSDNSLDPGLFVESTRK
GSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKE
SYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTC
QQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQ
EEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEG
EDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQE
LSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Isotype
IgG
Antibody clone number
1C3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -