HPA014509

OPRM1 antibody from Sigma-Aldrich
MOR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014509
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014509, RRID:AB_1854801
Product name
Anti-OPRM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014509
Antibody type
Polyclonal
Antigen
Mu-type opioid receptor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTLLSVSARTGFCKKQQELWQRRKEAAEALGTRKV
SVLLATSHSGARPAVSTMDSSAAPTNASNCTDALA
YSSCSPAPSPGSWVNLSHLDGNLSDPCGPNRTDLG
GRDSLCPPTGSP
Storage
-20C
Provider Type Product Number
- No reagents -