HPA029077

MID2 antibody from MilliporeSigma / Merck KGaA
FXY2, MRX101, RNF60, TRIM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029077
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029077, RRID:AB_10603019
Product name
Anti-MID2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029077
Antibody type
Polyclonal
Antigen
midline 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPH
LKRLGVLLDYDNNMLSFY
Storage
-20C
Provider Type Product Number
- No reagents -