HPA028115

ARHGEF10L antibody from Sigma-Aldrich
FLJ10521, KIAA1626
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028115
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028115, RRID:AB_10602285
Product name
Anti-ARHGEF10L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028115
Antibody type
Polyclonal
Antigen
Rho guanine nucleotide exchange factor (GEF) 10-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LLCETLTETVYGDRGQLIKSKERRVFLLNDMLVCA
NINFKPANHRGQLEISSLVPLGPKYVVKWNTALPQ
VQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQ
NKVYL
Storage
-20C
Provider Type Product Number
- No reagents -