HPA013952

CELSR2 antibody from Sigma-Aldrich
ADGRC2, CDHF10, EGFL2, Flamingo1, KIAA0279, MEGF3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013952
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013952, RRID:AB_1846518
Product name
Anti-CELSR2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013952
Antibody type
Polyclonal
Antigen
Cadherin EGF LAG seven-pass G-type receptor 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SATQDVHFTENLLRVGSALLDTANKRHWELIQQTE
GGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPN
IVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETT
VILPESVFRETPPVVRPAGPGEAQEPEELARRQRR
HPELSQ
Storage
-20C
Provider Type Product Number
- No reagents -