HPA015701

GRM1 antibody from Sigma-Aldrich
GPRC1A, mGlu1, MGLUR1, PPP1R85
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015701
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015701, RRID:AB_1853917
Product name
Anti-GRM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015701
Antibody type
Polyclonal
Antigen
Metabotropic glutamate receptor 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PKGQHMWHRLSVHVKTNETACNQTAVIKPLTKSYQ
GSGKSLTFSDTSTKTLYNVEEEEDAQPIRFSPPGS
PSMVVHRRVPSAATTPPLPSHLTAEETPLFLAEPA
LPKGLPPPLQQQQQPPPQQKSLMDQ
Storage
-20C
Provider Type Product Number
- No reagents -