Antibody data

Product number
H00222663-M07
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00222663-M07, RRID:AB_1137436
Product name
SCUBE3 monoclonal antibody (M07), clone 1D6
Provider product page
Abnova Corporation - H00222663-M07
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SCUBE3.
Antigen sequence
DVDECVEGTDNCHIDAICQNTPRSYKCICKSGYTG
DGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCY
DGFHLAHDGHNCLDVDECAEGNGGCQQSCVNMMGS
YECHCREGFFLSDN
Isotype
IgG
Antibody clone number
1D6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -