HPA042186

antibody from Atlas Antibodies

Targeting: HSD11B2 SDR9C3

Antibody data

Submit

Validation data

Product number: HPA042186 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA042186, RRID:AB_2677888
Product name: Anti-HSD11B2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVK VSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQEL LQAYGKDYIEHLHGQFLHSLR
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

HSD11B2 protein structure - HPA042186 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and liver tissues using Anti-HSD11B2 antibody. Corresponding HSD11B2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human kidney, liver, lymph node and rectum using Anti-HSD11B2 antibody HPA042186 (A) shows similar protein distribution across tissues to independent antibody HPA056385 (B).
Antibody #2 product nr: HPA056385
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in distal tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node using Anti-HSD11B2 antibody HPA042186.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human rectum using Anti-HSD11B2 antibody HPA042186.
Sample type: HUMAN