Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002033-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002033-M01, RRID:AB_463858
- Product name
- EP300 monoclonal antibody (M01), clone 1B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EP300.
- Antigen sequence
PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFL
PQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSS
CPVNSPIMPPGSQGSHIHCPQLPQPALHQN- Isotype
- IgG
- Antibody clone number
- 1B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references p300 alters keratinocyte cell growth and differentiation through regulation of p21(Waf1/CIP1).
Wong PP, Pickard A, McCance DJ
PloS one 2010 Jan 13;5(1):e8369
PloS one 2010 Jan 13;5(1):e8369
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to EP300 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EP300 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol