HPA003128

EP300 antibody from Sigma-Aldrich
KAT3B, p300
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003128
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003128, RRID:AB_1078745
Product name
Anti-EP300 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003128
Antibody type
Polyclonal
Antigen
Histone acetyltransferase p300 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSS
SSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPS
PVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPA
MPPGPQSQALHPPPRQTPTPPTTQLPQQ
Storage
-20C
Provider Type Product Number
- No reagents -