HPA014858

BCAR3 antibody from Sigma-Aldrich
NSP2, SH2D3B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014858
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014858, RRID:AB_1845302
Product name
Anti-BCAR3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014858
Antibody type
Polyclonal
Antigen
Breast cancer anti-estrogen resistance protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDD
FSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGE
TFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKK
EL
Storage
-20C
Provider Type Product Number
- No reagents -