HPA014858

BCAR3 antibody from Atlas Antibodies
AND-34, NSP2, SH2D3B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014858
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014858, RRID:AB_1845302
Product name
Anti-BCAR3
Provider product page
Atlas Antibodies - HPA014858
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SPLAEHRPDAYQDVSIHGTLPRKKKGPPPIRSCDD
FSHMGTLPHSKSPRQNSPVTQDGIQESPWQDRHGE
TFTFRDPHLLDPTVEYVKFSKERHIMDRTPEKLKK
EL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -