HPA015037

ARID5B antibody from Sigma-Aldrich
FLJ21150, MRF2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015037
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015037, RRID:AB_1845015
Product name
Anti-ARID5B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015037
Antibody type
Polyclonal
Antigen
AT-rich interactive domain-containing protein 5B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSL
HLQDKKSAAAEAPTDDQPTDLSLPKNPHKPTGKVL
GLAHSTTGPQESKGISQFQVLGSQSRDCHPKACRV
SPMTMSGPKKYPESLSRSGKPHHVRLENFRKME
Storage
-20C
Provider Type Product Number
- No reagents -