Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [4]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA016493 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA016493, RRID:AB_1845414
- Product name
- Anti-BPGM
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLD
QLPRSESLKDVLERLLPYWNERIAPEVLRGKTILI
SAHGNSSRALLKHLEGISDEDIINITLPTGVPILL
ELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVK
QA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Affinity Proteomics Reveals Elevated Muscle Proteins in Plasma of Children with Cerebral Malaria
Bachmann J, Burté F, Pramana S, Conte I, Brown B, Orimadegun A, Ajetunmobi W, Afolabi N, Akinkunmi F, Omokhodion S, Akinbami F, Shokunbi W, Kampf C, Pawitan Y, Uhlén M, Sodeinde O, Schwenk J, Wahlgren M, Fernandez-Reyes D, Nilsson P, Kim K
PLoS Pathogens 2014 April;10(4)
PLoS Pathogens 2014 April;10(4)
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
- Sample type
- MOUSE, RAT
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line U-251 MG.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human placenta and pancreas tissues using Anti-BPGM antibody. Corresponding BPGM RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human placenta shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN