Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010435-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010435-M01, RRID:AB_518712
- Product name
- CDC42EP2 monoclonal antibody (M01), clone 2H7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDC42EP2.
- Antigen sequence
PLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLE
TPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEE
PFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSM
QIPT- Isotype
- IgG
- Antibody clone number
- 2H7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Protein array analysis of oligomerization-induced changes in alpha-synuclein protein-protein interactions points to an interference with Cdc42 effector proteins.
Schnack C, Danzer KM, Hengerer B, Gillardon F
Neuroscience 2008 Jul 17;154(4):1450-7
Neuroscience 2008 Jul 17;154(4):1450-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CDC42EP2 expression in transfected 293T cell line by CDC42EP2 monoclonal antibody (M01), clone 2H7.Lane 1: CDC42EP2 transfected lysate(22.5 KDa).Lane 2: Non-transfected lysate.