Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA042451 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA042451, RRID:AB_10806239
- Product name
- Anti-SETD2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYV
DPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGH
STEPLSAPPPVPVVPHVAAPVEVSSSQYVA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references SETD2 loss-of-function promotes renal cancer branched evolution through replication stress and impaired DNA repair.
Kanu N, Grönroos E, Martinez P, Burrell RA, Yi Goh X, Bartkova J, Maya-Mendoza A, Mistrík M, Rowan AJ, Patel H, Rabinowitz A, East P, Wilson G, Santos CR, McGranahan N, Gulati S, Gerlinger M, Birkbak NJ, Joshi T, Alexandrov LB, Stratton MR, Powles T, Matthews N, Bates PA, Stewart A, Szallasi Z, Larkin J, Bartek J, Swanton C
Oncogene 2015 Nov 12;34(46):5699-708
Oncogene 2015 Nov 12;34(46):5699-708
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nuclear speckles & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human oral mucosa shows moderate nuclear positivity in squamous epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human endometrium shows strong nuclear positivity in glandular and stromal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows moderate nuclear positivity in Purkinje cells as well as in cells in molecular layer.
- Sample type
- HUMAN
